SCOP 1.69: Domain d1fgub1: 1fgu B:181-289

Lineage for d1fgub1 (1fgu B:181-289)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (10 proteins)
   barrel, closed; n=5, S=10

6. Protein Replication protein A 70 KDa subunit (RPA70) [50267] (1 species)
   duplication: consists of three domains of this fold; contains zinc-finger insert in the C-terminal domain, residues 479-511

7. Species Human (Homo sapiens) [TaxId:9606] [50268] (4 PDB entries)

8. Domain d1fgub1: 1fgu B:181-289 [25298]

Details for d1fgub1

PDB Entry: 1fgu, 2.5 Å

PDB Description: ssdna-binding domain of the large subunit of replication protein a

SCOP Domain Sequences for d1fgub1:

Sequence; same for both SEQRES and ATOM records:

>d1fgub1 b.40.4.3 (B:181-289) Replication protein A 70 KDa subunit (RPA70) {Human (Homo sapiens)}
mskvvpiasltpyqskwticarvtnksqirtwsnsrgegklfslelvdesgeiratafne
qvdkffplievnkvyyfskgtlkiankqftavkndyemtfnnetsvmpc

Timeline for d1fgub1:

• d1fgub1 first appeared (with stable ids) in SCOP 1.55
  
• d1fgub1 appears in SCOP 1.67
  
• d1fgub1 appears in SCOP 1.71
  
• d1fgub1 appears in the current release, SCOPe 2.08