SCOPe 2.04: Domain d4jdka_: 4jdk A:

Lineage for d4jdka_ (4jdk A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (476 PDB entries)

8. Domain d4jdka_: 4jdk A: [252905]
   automated match to d2q0na_
   mutant

Details for d4jdka_

PDB Entry: 4jdk, 2.4 Å

PDB Description: Crystal structure of Serine/threonine-protein kinase PAK 4 F461V mutant in complex with Paktide S peptide substrate

PDB Compounds: (A:) serine/threonine-protein kinase pak 4

SCOPe Domain Sequences for d4jdka_:

Sequence; same for both SEQRES and ATOM records:

>d4jdka_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sheqfraalqlvvdpgdprsyldnfikigegstgivciatvrssgklvavkkmdlrkqqr
rellfnevvimrdyqhenvvemynsylvgdelwvvmefleggaltdivthtrmneeqiaa
vclavlqalsvlhaqgvihrdiksdsillthdgrvklsdfgvcaqvskevprrkslvgtp
ywmapelisrlpygpevdiwslgimviemvdgeppyfnepplkamkmirdnlpprlknlh
kvspslkgfldrllvrdpaqrataaellkhpflakagppasivplmrqnr

Timeline for d4jdka_:

• d4jdka_ is new in SCOPe 2.04-stable
  
• d4jdka_ appears in SCOPe 2.05
  
• d4jdka_ appears in the current release, SCOPe 2.08