SCOPe 2.07: Domain d4jcla4: 4jcl A:585-687

Lineage for d4jcla4 (4jcl A:585-687)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (4 families)

5. Family b.3.1.0: automated matches [254199] (1 protein)
   not a true family

6. Protein automated matches [254436] (5 species)
   not a true protein

7. Species Paenibacillus macerans [TaxId:44252] [256326] (4 PDB entries)

8. Domain d4jcla4: 4jcl A:585-687 [252885]
   Other proteins in same PDB: d4jcla1, d4jcla2, d4jcla3
   automated match to d3cgta2
   complexed with ca, cl, edo, gol, peg, pge

Details for d4jcla4

PDB Entry: 4jcl, 1.7 Å

PDB Description: Crystal structure of Alpha-CGT from Paenibacillus macerans at 1.7 Angstrom resolution

PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d4jcla4:

Sequence; same for both SEQRES and ATOM records:

>d4jcla4 b.3.1.0 (A:585-687) automated matches {Paenibacillus macerans [TaxId: 44252]}
gdqvtvrflvnqantnygtnvylvgnaaelgswdpnkaigpmynqviakypswyydvsvp
agtkldfkfikkgggtvtwegggnhtyttpasgvgtvtvdwqn

Timeline for d4jcla4:

• d4jcla4 first appeared in SCOPe 2.04
  
• d4jcla4 appears in SCOPe 2.06
  
• d4jcla4 appears in the current release, SCOPe 2.08