SCOPe 2.08: Domain d4jbjb2: 4jbj B:113-199

Lineage for d4jbjb2 (4jbj B:113-199)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.16: HIN-2000 domain-like [159141] (2 families)
   duplication: tandem repeat of two OB-fold domains

5. Family b.40.16.0: automated matches [233467] (1 protein)
   not a true family

6. Protein automated matches [233468] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [234954] (5 PDB entries)

8. Domain d4jbjb2: 4jbj B:113-199 [252863]
   Other proteins in same PDB: d4jbja3, d4jbjb3
   automated match to d2oq0a1

Details for d4jbjb2

PDB Entry: 4jbj, 2.69 Å

PDB Description: Structural mimicry for functional antagonism

PDB Compounds: (B:) Interferon-activable protein 202

SCOPe Domain Sequences for d4jbjb2:

Sequence, based on SEQRES records:

>d4jbjb2 b.40.16.0 (B:113-199) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lkiskikeldsgtliygvfavekkkvndksitfkikdnednikvvwdkeqhninyekgdk
lqlfsfhlrkgngkpilhsgnhsfikg

Sequence, based on observed residues (ATOM records):

>d4jbjb2 b.40.16.0 (B:113-199) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lkiskikeldsgtliygvfavekkkvndksitfkikdnednikvvwdkeqhnikgdklql
fsfhlrkgngkpilhsgnhsfikg

Timeline for d4jbjb2:

• d4jbjb2 first appeared in SCOPe 2.04
  
• d4jbjb2 appears in SCOPe 2.07