Class b: All beta proteins [48724] (178 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
Protein automated matches [226946] (29 species) not a true protein |
Species Pseudomonas putida [TaxId:160488] [256312] (2 PDB entries) |
Domain d4iw3b2: 4iw3 B:206-304 [252733] Other proteins in same PDB: d4iw3a_, d4iw3b1, d4iw3b3, d4iw3j_, d4iw3k1, d4iw3k3 automated match to d1b23p1 complexed with gdp, mg, mn, oga |
PDB Entry: 4iw3 (more details), 2.7 Å
SCOPe Domain Sequences for d4iw3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iw3b2 b.43.3.0 (B:206-304) automated matches {Pseudomonas putida [TaxId: 160488]} pvraidqpflmpiedvfsisgrgtvvtgriergivrvqdpleivglrdtttttctgvemf rklldegragencgvllrgtkrddvergqvlvkpgsvkp
Timeline for d4iw3b2: