SCOPe 2.05: Domain d4iuga2: 4iug A:394-566

Lineage for d4iuga2 (4iug A:394-566)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (30 species)
   not a true protein

7. Species Fungus (Aspergillus oryzae) [TaxId:5062] [256308] (1 PDB entry)

8. Domain d4iuga2: 4iug A:394-566 [252721]
   Other proteins in same PDB: d4iuga1, d4iuga3, d4iuga4, d4iuga5
   automated match to d1tg7a4
   complexed with cd, gal, m6d, nag

Details for d4iuga2

PDB Entry: 4iug, 2.6 Å

PDB Description: crystal structure of beta-galactosidase from aspergillus oryzae in complex with galactose

PDB Compounds: (A:) Beta-galactosidase A

SCOPe Domain Sequences for d4iuga2:

Sequence; same for both SEQRES and ATOM records:

>d4iuga2 b.71.1.0 (A:394-566) automated matches {Fungus (Aspergillus oryzae) [TaxId: 5062]}
syltatprnlttgvytdtsdlavtpligdspgsffvvrhtdyssqestsyklklptsagn
ltipqlegtlslngrdskihvvdynvsgtniiystaevftwkkfdgnkvlvlyggpkehh
elaiasksnvtiiegsdsgivstrkgssviigwdvsstrrivqvgdlrvflld

Timeline for d4iuga2:

• d4iuga2 first appeared in SCOPe 2.04
  
• d4iuga2 appears in SCOPe 2.06
  
• d4iuga2 appears in the current release, SCOPe 2.08