Lineage for d4iuga2 (4iug A:394-566)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2066963Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2066964Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2067553Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2067554Protein automated matches [226835] (34 species)
    not a true protein
  7. 2067623Species Fungus (Aspergillus oryzae) [TaxId:5062] [256308] (1 PDB entry)
  8. 2067624Domain d4iuga2: 4iug A:394-566 [252721]
    Other proteins in same PDB: d4iuga1, d4iuga3, d4iuga4, d4iuga5
    automated match to d1tg7a4
    complexed with cd, gal, m6d, nag

Details for d4iuga2

PDB Entry: 4iug (more details), 2.6 Å

PDB Description: Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose
PDB Compounds: (A:) Beta-galactosidase A

SCOPe Domain Sequences for d4iuga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iuga2 b.71.1.0 (A:394-566) automated matches {Fungus (Aspergillus oryzae) [TaxId: 5062]}
syltatprnlttgvytdtsdlavtpligdspgsffvvrhtdyssqestsyklklptsagn
ltipqlegtlslngrdskihvvdynvsgtniiystaevftwkkfdgnkvlvlyggpkehh
elaiasksnvtiiegsdsgivstrkgssviigwdvsstrrivqvgdlrvflld

SCOPe Domain Coordinates for d4iuga2:

Click to download the PDB-style file with coordinates for d4iuga2.
(The format of our PDB-style files is described here.)

Timeline for d4iuga2: