SCOPe 2.08: Domain d4iqua3: 4iqu A:303-510

Lineage for d4iqua3 (4iqu A:303-510)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
   core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123

4. Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families)

5. Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
   insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain

6. Protein automated matches [254484] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [256295] (30 PDB entries)

8. Domain d4iqua3: 4iqu A:303-510 [252677]
   Other proteins in same PDB: d4iqua1, d4iqua2
   automated match to d1jmsa4
   complexed with 1fq, na

Details for d4iqua3

PDB Entry: 4iqu, 2.4 Å

PDB Description: tdt core in complex with inhibitor (2z,5e)-6-[4-(4-fluorobenzoyl)-1h- pyrrol-2-yl]-2-hydroxy-4-oxohexa-2,5-dienoic acid

PDB Compounds: (A:) DNA nucleotidylexotransferase

SCOPe Domain Sequences for d4iqua3:

Sequence, based on SEQRES records:

>d4iqua3 d.218.1.2 (A:303-510) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vnrpeaeavsmlvkeavvtflpdalvtmtggfrrgkmtghdvdflitspeatedeeqqll
hkvtdfwkqqglllycdilestfekfkqpsrkvdaldhfqkcflilkldhgrvhseksgq
qegkgwkairvdlvmcpydrrafallgwtgsrqferdlrryatherkmmldnhalydrtk
rvfleaeseeeifahlgldyiepwerna

Sequence, based on observed residues (ATOM records):

>d4iqua3 d.218.1.2 (A:303-510) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vnrpeaeavsmlvkeavvtflpdalvtmtggfrrgkmtghdvdflitspeatedeeqqll
hkvtdfwkqqglllycdilestfekfkqpsrkvdaldhfqkcflilkldhgrvhsekegk
gwkairvdlvmcpydrrafallgwtgsrqferdlrryatherkmmldnhalydrtkrvfl
eaeseeeifahlgldyiepwerna

Timeline for d4iqua3:

• d4iqua3 first appeared in SCOPe 2.04
  
• d4iqua3 appears in SCOPe 2.07