SCOPe 2.08: Domain d4i78d1: 4i78 D:6-174

Lineage for d4i78d1 (4i78 D:6-174)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (22 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)

8. Domain d4i78d1: 4i78 D:6-174 [252592]
   Other proteins in same PDB: d4i78a_, d4i78b_, d4i78c2, d4i78d2
   automated match to d4n5zb_
   complexed with nag

Details for d4i78d1

PDB Entry: 4i78, 3.18 Å

PDB Description: crystal structure of a subtype h17 hemagglutinin homologue from a/little yellow-shouldered bat/guatemala/060/2010 (h17n10)

PDB Compounds: (D:) hemagglutinin HA2

SCOPe Domain Sequences for d4i78d1:

Sequence; same for both SEQRES and ATOM records:

>d4i78d1 h.3.1.1 (D:6-174) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
iagfieggwqgmidgwygyhhenqegsgyaadkeatqkavdgitnkvnsiidkmnsqfes
nikefnrlelriqhlsdrvddalldiwsyntellvllenertldfhdanvknlfekvkaq
lkdnaidegngcflllhkcnnscmddikngtykymdyreeshiekqkid

Timeline for d4i78d1:

• d4i78d1 first appeared in SCOPe 2.04, called d4i78d_
  
• d4i78d1 appears in SCOPe 2.07