![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
![]() | Protein automated matches [227017] (58 species) not a true protein |
![]() | Species Influenza A virus (a/little yellow-shouldered bat/guatemala/060/2010(h17n10)) [TaxId:1129347] [256297] (1 PDB entry) |
![]() | Domain d4i78b_: 4i78 B: [252590] Other proteins in same PDB: d4i78c1, d4i78c2, d4i78d1, d4i78d2 automated match to d3gbna_ complexed with nag |
PDB Entry: 4i78 (more details), 3.18 Å
SCOPe Domain Sequences for d4i78b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i78b_ b.19.1.0 (B:) automated matches {Influenza A virus (a/little yellow-shouldered bat/guatemala/060/2010(h17n10)) [TaxId: 1129347]} dricigyqanqnnqtvntlleqnvpvtgaqeiletnhngklcslngvppldlqsctlagw llgnpncdnlleaeewsyikinenapddlcfpgnfenlqdlllemsgvqnftkvklfnpq smtgvttnnvdqtcpfegkpsfyrnlnwiqgnsglpfnieiknptsnpllllwgihntkd aaqqrnlygndysytifnfgekseefrpdigqrdeikahqdridyywgslpaqstlries tgnliapeygfyykrkegkgglmksklpisdcstkcqtplgalnstlpfqnvhqqtignc pkyvkatslmlatglrnnp
Timeline for d4i78b_: