Lineage for d4i78b_ (4i78 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776338Species Influenza A virus (a/little yellow-shouldered bat/guatemala/060/2010(h17n10)) [TaxId:1129347] [256297] (1 PDB entry)
  8. 2776340Domain d4i78b_: 4i78 B: [252590]
    Other proteins in same PDB: d4i78c1, d4i78c2, d4i78d1, d4i78d2
    automated match to d3gbna_
    complexed with nag

Details for d4i78b_

PDB Entry: 4i78 (more details), 3.18 Å

PDB Description: crystal structure of a subtype h17 hemagglutinin homologue from a/little yellow-shouldered bat/guatemala/060/2010 (h17n10)
PDB Compounds: (B:) hemagglutinin HA1

SCOPe Domain Sequences for d4i78b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i78b_ b.19.1.0 (B:) automated matches {Influenza A virus (a/little yellow-shouldered bat/guatemala/060/2010(h17n10)) [TaxId: 1129347]}
dricigyqanqnnqtvntlleqnvpvtgaqeiletnhngklcslngvppldlqsctlagw
llgnpncdnlleaeewsyikinenapddlcfpgnfenlqdlllemsgvqnftkvklfnpq
smtgvttnnvdqtcpfegkpsfyrnlnwiqgnsglpfnieiknptsnpllllwgihntkd
aaqqrnlygndysytifnfgekseefrpdigqrdeikahqdridyywgslpaqstlries
tgnliapeygfyykrkegkgglmksklpisdcstkcqtplgalnstlpfqnvhqqtignc
pkyvkatslmlatglrnnp

SCOPe Domain Coordinates for d4i78b_:

Click to download the PDB-style file with coordinates for d4i78b_.
(The format of our PDB-style files is described here.)

Timeline for d4i78b_: