Lineage for d4huwa1 (4huw A:1-181)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1897285Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1897685Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (47 PDB entries)
    Uniprot P01901 22-299
  8. 1897743Domain d4huwa1: 4huw A:1-181 [252506]
    Other proteins in same PDB: d4huwa2, d4huwb_, d4huwc2, d4huwd_, d4huwe2, d4huwf_, d4huwg2, d4huwh_
    automated match to d1kj3h2
    complexed with so4

Details for d4huwa1

PDB Entry: 4huw (more details), 3.16 Å

PDB Description: crystal structure of h2db-npm6t
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d4huwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4huwa1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

SCOPe Domain Coordinates for d4huwa1:

Click to download the PDB-style file with coordinates for d4huwa1.
(The format of our PDB-style files is described here.)

Timeline for d4huwa1: