Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (18 species) not a true protein |
Species Dogfish (Squalus acanthias) [TaxId:7797] [226656] (2 PDB entries) |
Domain d4hgkd_: 4hgk D: [252447] Other proteins in same PDB: d4hgka1, d4hgka2, d4hgkb1, d4hgkb2 automated match to d4hgma_ |
PDB Entry: 4hgk (more details), 3.04 Å
SCOPe Domain Sequences for d4hgkd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hgkd_ b.1.1.1 (D:) automated matches {Dogfish (Squalus acanthias) [TaxId: 7797]} trvdqtprtatretgesltincvltdtsyplystywyrknpgssnkeqisisgryvesvn kgtksfslrikdltvadsatyicramgtniwtgdgagtvltvnh
Timeline for d4hgkd_: