Lineage for d1aszb1 (1asz B:68-204)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1314543Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1314544Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
    barrel, closed; n=5, S=10
  6. 1314545Protein Aspartyl-tRNA synthetase (AspRS) [50251] (5 species)
    this is N-terminal domain in prokaryotic enzymes and the first "visible" domain in eukaryotic enzymes
  7. 1314546Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50252] (3 PDB entries)
  8. 1314549Domain d1aszb1: 1asz B:68-204 [25241]
    Other proteins in same PDB: d1asza2, d1aszb2
    protein/RNA complex; complexed with atp

Details for d1aszb1

PDB Entry: 1asz (more details), 3 Å

PDB Description: the active site of yeast aspartyl-trna synthetase: structural and functional aspects of the aminoacylation reaction
PDB Compounds: (B:) ASPARTYL-tRNA SYNTHETASE

SCOPe Domain Sequences for d1aszb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aszb1 b.40.4.1 (B:68-204) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
edtakdnygklpliqsrdsdrtgqkrvkfvdldeakdsdkevlfrarvhntrqqgatlaf
ltlrqqasliqglvkankegtisknmvkwagslnlesivlvrgivkkvdepiksatvqnl
eihitkiytisetpeal

SCOPe Domain Coordinates for d1aszb1:

Click to download the PDB-style file with coordinates for d1aszb1.
(The format of our PDB-style files is described here.)

Timeline for d1aszb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aszb2