Lineage for d4h9ga3 (4h9g A:313-405)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1544753Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544754Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 1544858Family b.44.1.0: automated matches [254194] (1 protein)
    not a true family
  6. 1544859Protein automated matches [254425] (11 species)
    not a true protein
  7. 1544903Species Thermus thermophilus [TaxId:274] [256285] (6 PDB entries)
  8. 1544905Domain d4h9ga3: 4h9g A:313-405 [252404]
    Other proteins in same PDB: d4h9ga1, d4h9ga2
    automated match to d1b23p2
    complexed with 14j, gnp, mg, nh4, so4

Details for d4h9ga3

PDB Entry: 4h9g (more details), 1.93 Å

PDB Description: probing ef-tu with a very small brominated fragment library identifies the cca pocket
PDB Compounds: (A:) elongation factor tu-a

SCOPe Domain Sequences for d4h9ga3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h9ga3 b.44.1.0 (A:313-405) automated matches {Thermus thermophilus [TaxId: 274]}
htkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

SCOPe Domain Coordinates for d4h9ga3:

Click to download the PDB-style file with coordinates for d4h9ga3.
(The format of our PDB-style files is described here.)

Timeline for d4h9ga3: