Lineage for d4h1ia_ (4h1i A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1666639Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1666640Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 1666641Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 1666899Protein automated matches [190469] (12 species)
    not a true protein
  7. 1666949Species Human (Homo sapiens) [TaxId:9606] [189245] (16 PDB entries)
  8. 1666976Domain d4h1ia_: 4h1i A: [252362]
    automated match to d4eb4a_
    complexed with so4

Details for d4h1ia_

PDB Entry: 4h1i (more details), 3.1 Å

PDB Description: Structure of human thymidylate synthase at low salt conditions
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d4h1ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h1ia_ d.117.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl
eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae
yrdmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn
selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl
kiqlqreprpfpklrilrkvekiddfkaedfqiegynphpt

SCOPe Domain Coordinates for d4h1ia_:

Click to download the PDB-style file with coordinates for d4h1ia_.
(The format of our PDB-style files is described here.)

Timeline for d4h1ia_: