Lineage for d1br9a_ (1br9 A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1124594Superfamily b.40.3: TIMP-like [50242] (3 families) (S)
  5. 1124595Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (3 proteins)
    contains an irregular alpha+beta subdomain in the C-terminal extension
  6. 1124605Protein TIMP-2 [50246] (2 species)
  7. 1124609Species Human (Homo sapiens) [TaxId:9606] [50247] (3 PDB entries)
  8. 1124610Domain d1br9a_: 1br9 A: [25235]

Details for d1br9a_

PDB Entry: 1br9 (more details), 2.1 Å

PDB Description: human tissue inhibitor of metalloproteinase-2
PDB Compounds: (A:) metalloproteinase-2 inhibitor

SCOPe Domain Sequences for d1br9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1br9a_ b.40.3.1 (A:) TIMP-2 {Human (Homo sapiens) [TaxId: 9606]}
cscspvhpqqafcnadvvirakavsekevdsgndiygnpikriqyeikqikmfkgpekdi
efiytapssavcgvsldvggkkeyliagkaegdgkmhitlcdfivpwdtlsttqkkslnh
ryqmgceckitrcpmipcyisspdeclwmdwvtekninghqakffacikrsdgscawyrg
aa

SCOPe Domain Coordinates for d1br9a_:

Click to download the PDB-style file with coordinates for d1br9a_.
(The format of our PDB-style files is described here.)

Timeline for d1br9a_: