SCOPe 2.04: Domain d1d2ba_: 1d2b A:

Lineage for d1d2ba_ (1d2b A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.3: TIMP-like [50242] (4 families)

5. Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 proteins)
   contains an irregular alpha+beta subdomain in the C-terminal extension
   automatically mapped to Pfam PF00965

6. Protein TIMP-1 [50244] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50245] (6 PDB entries)

8. Domain d1d2ba_: 1d2b A: [25234]

Details for d1d2ba_

PDB Entry: 1d2b

PDB Description: the mmp-inhibitory, n-terminal domain of human tissue inhibitor of metalloproteinases-1 (n-timp-1), solution nmr, 29 structures

PDB Compounds: (A:) tissue inhibitor of metalloproteinases-1

SCOPe Domain Sequences for d1d2ba_:

Sequence; same for both SEQRES and ATOM records:

>d1d2ba_ b.40.3.1 (A:) TIMP-1 {Human (Homo sapiens) [TaxId: 9606]}
ctcvpphpqtafcnsdlvirakfvgtpevnqttlyqryeikmtkmykgfqalgdaadirf
vytpamesvcgyfhrshnrseefliagklqdgllhittcsfvapwnslslaqrrgftkty
tvgcee

Timeline for d1d2ba_:

• d1d2ba_ first appeared (with stable ids) in SCOP 1.55
  
• d1d2ba_ appears in SCOPe 2.03
  
• d1d2ba_ appears in SCOPe 2.05
  
• d1d2ba_ appears in the current release, SCOPe 2.08