Lineage for d4ggba1 (4ggb A:1-123)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1649013Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1649014Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1649263Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1649264Protein automated matches [226922] (67 species)
    not a true protein
  7. 1649285Species Agrobacterium tumefaciens [TaxId:176299] [226505] (6 PDB entries)
  8. 1649294Domain d4ggba1: 4ggb A:1-123 [252212]
    Other proteins in same PDB: d4ggba2
    automated match to d3sjna1
    complexed with ca, cl

Details for d4ggba1

PDB Entry: 4ggb (more details), 2 Å

PDB Description: crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, disordered loops
PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d4ggba1:

Sequence, based on SEQRES records: (download)

>d4ggba1 d.54.1.0 (A:1-123) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
mkitavrthllehrldtpfesasmrfdrrahvlveiecddgtvgwgeclgparpnaavvq
aysgwligqdprqtekiwavlynalrdqgqrglsltalsgidialwdikgkhygasisml
lgg

Sequence, based on observed residues (ATOM records): (download)

>d4ggba1 d.54.1.0 (A:1-123) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
mkitavrthllhvlveiecddgtvgwgeclgparpnaavvqaysgwligqdprqtekiwa
vlynalrdqgqrglsltalsgidialwdikgkhygasismllgg

SCOPe Domain Coordinates for d4ggba1:

Click to download the PDB-style file with coordinates for d4ggba1.
(The format of our PDB-style files is described here.)

Timeline for d4ggba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ggba2