Lineage for d4gaab3 (4gaa B:458-606)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2338495Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2339141Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2339142Protein automated matches [190220] (14 species)
    not a true protein
  7. 2339143Species African clawed frog (Xenopus laevis) [TaxId:8355] [256268] (1 PDB entry)
  8. 2339145Domain d4gaab3: 4gaa B:458-606 [252172]
    Other proteins in same PDB: d4gaaa1, d4gaaa2, d4gaab1, d4gaab2
    automated match to d3fh8a3
    complexed with bes, zn

Details for d4gaab3

PDB Entry: 4gaa (more details), 2.26 Å

PDB Description: Structure of Leukotriene A4 hydrolase from Xenopus laevis complexed with inhibitor bestatin
PDB Compounds: (B:) MGC78867 protein

SCOPe Domain Sequences for d4gaab3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gaab3 a.118.1.0 (B:458-606) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
dmtlanacitlgqkwvkatesdlgsfsaddvkdlsshqlievlailllekplpvshvkrm
qevynlndvknseirfrwlrlciragwedviplalamateqgrmkftrplyrdlynfeka
reqtvntflknrsfmhpvtemlvakdlhi

SCOPe Domain Coordinates for d4gaab3:

Click to download the PDB-style file with coordinates for d4gaab3.
(The format of our PDB-style files is described here.)

Timeline for d4gaab3: