SCOPe 2.02: Domain d1b1zb1: 1b1z B:3-107

Lineage for d1b1zb1 (1b1z B:3-107)

Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds)
Fold b.40: OB-fold [50198] (16 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)
Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (15 proteins)
Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
Species Streptococcus pyogenes [TaxId:1314] [50241] (8 PDB entries)
Uniprot P08095
Domain d1b1zb1: 1b1z B:3-107 [25217]
Other proteins in same PDB: d1b1za2, d1b1zb2, d1b1zc2, d1b1zd2

Details for d1b1zb1

PDB Entry: 1b1z (more details), 2.57 Å

PDB Description: streptococcal pyrogenic exotoxin a1

PDB Compounds: (B:) protein (toxin)

SCOPe Domain Sequences for d1b1zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b1zb1 b.40.2.2 (B:3-107) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
dpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklktel
knqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe

SCOPe Domain Coordinates for d1b1zb1:

Click to download the PDB-style file with coordinates for d1b1zb1.
(The format of our PDB-style files is described here.)

Timeline for d1b1zb1: