Lineage for d4g9jb_ (4g9j B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1679877Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1679878Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1679954Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 1680045Protein automated matches [190344] (1 species)
    not a true protein
  7. 1680046Species Human (Homo sapiens) [TaxId:9606] [187171] (6 PDB entries)
  8. 1680058Domain d4g9jb_: 4g9j B: [252166]
    automated match to d1s70a_
    complexed with mn

Details for d4g9jb_

PDB Entry: 4g9j (more details), 3.1 Å

PDB Description: Protein Ser/Thr phosphatase-1 in complex with cell-permeable peptide
PDB Compounds: (B:) Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

SCOPe Domain Sequences for d4g9jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g9jb_ d.159.1.3 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpad

SCOPe Domain Coordinates for d4g9jb_:

Click to download the PDB-style file with coordinates for d4g9jb_.
(The format of our PDB-style files is described here.)

Timeline for d4g9jb_: