SCOPe 2.02: Domain d1fnud1: 1fnu D:901-1007

Lineage for d1fnud1 (1fnu D:901-1007)

Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds)
Fold b.40: OB-fold [50198] (16 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)
Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (15 proteins)
Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
Species Streptococcus pyogenes [TaxId:1314] [50241] (8 PDB entries)
Uniprot P08095
Domain d1fnud1: 1fnu D:901-1007 [25215]
Other proteins in same PDB: d1fnua2, d1fnub2, d1fnuc2, d1fnud2
complexed with cd

Details for d1fnud1

PDB Entry: 1fnu (more details), 1.94 Å

PDB Description: structure of streptococcal pyrogenic exotoxin a

PDB Compounds: (D:) exotoxin type a precursor (allele 1)

SCOPe Domain Sequences for d1fnud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnud1 b.40.2.2 (D:901-1007) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe

SCOPe Domain Coordinates for d1fnud1:

Click to download the PDB-style file with coordinates for d1fnud1.
(The format of our PDB-style files is described here.)

Timeline for d1fnud1: