SCOPe 2.06: Domain d4fwra1: 4fwr A:4-192

Lineage for d4fwra1 (4fwr A:4-192)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.2: Acetokinase-like [53080] (4 proteins)

6. Protein Propionate kinase [142462] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [142463] (12 PDB entries)
   Uniprot O06961 193-397! Uniprot O06961 4-192

8. Domain d4fwra1: 4fwr A:4-192 [252091]
   automated match to d2e1za1
   complexed with c5p, edo

Details for d4fwra1

PDB Entry: 4fwr, 3 Å

PDB Description: crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with cmp

PDB Compounds: (A:) Propionate kinase

SCOPe Domain Sequences for d4fwra1:

Sequence; same for both SEQRES and ATOM records:

>d4fwra1 c.55.1.2 (A:4-192) Propionate kinase {Salmonella typhimurium [TaxId: 90371]}
fpvvlvincgsssikfsvldvatcdvlmagiadgmntenaflsingdkpinlahsnyeda
lkaiafelekrdltdsvalighriahggelftqsviitdeiidnirrvsplaplhnyanl
sgidaarhlfpavrqvavfdtsfhqtlapeaylyglpweyfsslgvrrygfhgtshryvs
rrayelldl

Timeline for d4fwra1:

• d4fwra1 first appeared in SCOPe 2.04
  
• d4fwra1 appears in SCOPe 2.05
  
• d4fwra1 appears in SCOPe 2.07
  
• d4fwra1 appears in the current release, SCOPe 2.08