Lineage for d4fpba1 (4fpb A:16-222)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605592Family c.55.1.3: Hexokinase [53083] (3 proteins)
  6. 1605614Protein Mammalian type I hexokinase [53086] (2 species)
    further duplication: consists of two very similar lobes
  7. 1605615Species Human (Homo sapiens) [TaxId:9606] [53087] (10 PDB entries)
  8. 1605676Domain d4fpba1: 4fpb A:16-222 [252061]
    automated match to d1czan1
    complexed with 0wk, bgc, cit, na

Details for d4fpba1

PDB Entry: 4fpb (more details), 3 Å

PDB Description: crystal structure of recombinant human hexokinase type i with 1,5- anhydroglucitol 6-phosphate
PDB Compounds: (A:) Hexokinase-1

SCOPe Domain Sequences for d4fpba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fpba1 c.55.1.3 (A:16-222) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]}
ddqvkkidkylyamrlsdetlidimtrfrkemknglsrdfnptatvkmlptfvrsipdgs
ekgdfialdlggssfrilrvqvnheknqnvhmesevydtpenivhgsgsqlfdhvaeclg
dfmekrkikdkklpvgftfsfpcqqskideailitwtkrfkasgvegadvvkllnkaikk
rgdydanivavvndtvgtmmtcgyddq

SCOPe Domain Coordinates for d4fpba1:

Click to download the PDB-style file with coordinates for d4fpba1.
(The format of our PDB-style files is described here.)

Timeline for d4fpba1: