SCOPe 2.04: Domain d4foia3: 4foi A:466-670

Lineage for d4foia3 (4foi A:466-670)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.3: Hexokinase [53083] (3 proteins)

6. Protein Mammalian type I hexokinase [53086] (2 species)
   further duplication: consists of two very similar lobes

7. Species Human (Homo sapiens) [TaxId:9606] [53087] (10 PDB entries)

8. Domain d4foia3: 4foi A:466-670 [252047]
   automated match to d1czan3
   complexed with bgc, cit, g16, na; mutant

Details for d4foia3

PDB Entry: 4foi, 2.4 Å

PDB Description: crystal structure of recombinant human hexokinase type i mutant d413n with glucose 1,6-bisphosphate

PDB Compounds: (A:) Hexokinase-1

SCOPe Domain Sequences for d4foia3:

Sequence; same for both SEQRES and ATOM records:

>d4foia3 c.55.1.3 (A:466-670) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]}
qhrqieetlahfhltkdmllevkkrmraemelglrkqthnnavvkmlpsfvrrtpdgten
gdflaldlggtnfrvllvkirsgkkrtvemhnkiyaipieimqgtgeelfdhivscisdf
ldymgikgprmplgftfsfpcqqtsldagilitwtkgfkatdcvghdvvtllrdaikrre
efdldvvavvndtvgtmmtcayeep

Timeline for d4foia3:

• d4foia3 is new in SCOPe 2.04-stable
  
• d4foia3 appears in SCOPe 2.05
  
• d4foia3 appears in the current release, SCOPe 2.08