Lineage for d1enfa1 (1enf A:2-101)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 166216Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 166278Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 166605Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)
  6. 166649Protein Staphylococcal enterotoxin H, SEH [50230] (1 species)
  7. 166650Species Staphylococcus aureus [TaxId:1280] [50231] (4 PDB entries)
  8. 166651Domain d1enfa1: 1enf A:2-101 [25198]
    Other proteins in same PDB: d1enfa2

Details for d1enfa1

PDB Entry: 1enf (more details), 1.69 Å

PDB Description: crystal structure of staphylococcal enterotoxin h determined to 1.69 a resolution

SCOP Domain Sequences for d1enfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1enfa1 b.40.2.2 (A:2-101) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus}
dlhdkseltdlalanaygqynhpfikeniksdeisgekdlifrnqgdsgndlrvkfatad
laqkfknknvdiygasfyykcekiseniseclyggttlns

SCOP Domain Coordinates for d1enfa1:

Click to download the PDB-style file with coordinates for d1enfa1.
(The format of our PDB-style files is described here.)

Timeline for d1enfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1enfa2