Lineage for d4f77z_ (4f77 Z:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2396390Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2396391Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2396392Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
    forms homo and heteroheptameric ring structures
    Pfam PF01423
  6. 2396611Protein D2 core SNRNP protein [50186] (3 species)
    3jb9 chains G and l are D2 subunits from fission yeast; not included because sids are not case sensitive
  7. 2396612Species Human (Homo sapiens) [TaxId:9606] [50187] (11 PDB entries)
  8. 2396628Domain d4f77z_: 4f77 Z: [251923]
    Other proteins in same PDB: d4f774_, d4f77a_, d4f77c_, d4f77d_, d4f77f_, d4f77g_, d4f77h_, d4f77i_, d4f77k_, d4f77l_, d4f77n_, d4f77o_, d4f77p_, d4f77q_, d4f77s_, d4f77t_, d4f77v_, d4f77w_, d4f77x_, d4f77y_
    complexed with so4
    complexed with so4

Details for d4f77z_

PDB Entry: 4f77 (more details), 3.1 Å

PDB Description: The 8S snRNP Assembly Intermediate
PDB Compounds: (Z:) Small nuclear ribonucleoprotein Sm D2

SCOPe Domain Sequences for d4f77z_:

Sequence, based on SEQRES records: (download)

>d4f77z_ b.38.1.1 (Z:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
pksemtpeelqkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmv
lenvkemwtevpksgkgkkkskpvnkdryiskmflrgdsvivvlrnpliag

Sequence, based on observed residues (ATOM records): (download)

>d4f77z_ b.38.1.1 (Z:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
pksemtpeelqkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmv
lenvkemwtevpvnkdryiskmflrgdsvivvlrnpliag

SCOPe Domain Coordinates for d4f77z_:

Click to download the PDB-style file with coordinates for d4f77z_.
(The format of our PDB-style files is described here.)

Timeline for d4f77z_: