SCOPe 2.05: Domain d4f77g_: 4f77 g:

Lineage for d4f77g_ (4f77 g:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
   forms homo and heteroheptameric ring structures

6. Protein D1 core SNRNP protein [50184] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50185] (5 PDB entries)

8. Domain d4f77g_: 4f77 g: [251908]
   Other proteins in same PDB: d4f774_, d4f77b_, d4f77d_, d4f77f_, d4f77h_, d4f77j_, d4f77l_, d4f77n_, d4f77p_, d4f77r_, d4f77t_, d4f77v_, d4f77x_, d4f77z_
   complexed with so4
   complexed with so4

Details for d4f77g_

PDB Entry: 4f77, 3.1 Å

PDB Description: The 8S snRNP Assembly Intermediate

PDB Compounds: (g:) Small nuclear ribonucleoprotein Sm D1

SCOPe Domain Sequences for d4f77g_:

Sequence; same for both SEQRES and ATOM records:

>d4f77g_ b.38.1.1 (g:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
klvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsir
gnniryfilpdslpldtllvdv

Timeline for d4f77g_:

• d4f77g_ first appeared in SCOPe 2.04
  
• d4f77g_ appears in SCOPe 2.06
  
• d4f77g_ appears in the current release, SCOPe 2.08