Class b: All beta proteins [48724] (176 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
Protein automated matches [190914] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [196227] (4 PDB entries) |
Domain d4f77f_: 4f77 f: [251907] Other proteins in same PDB: d4f77a_, d4f77b_, d4f77g_, d4f77i_, d4f77j_, d4f77o_, d4f77q_, d4f77r_, d4f77w_, d4f77y_, d4f77z_ complexed with so4 complexed with so4 |
PDB Entry: 4f77 (more details), 3.1 Å
SCOPe Domain Sequences for d4f77f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f77f_ b.38.1.0 (f:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hppelkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmvvirg nsiimleale
Timeline for d4f77f_: