SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1d5zc1 (1d5z C:2-121)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2050241Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2050816Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 protein domains)
  6. 2050838Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)
  7. 2050839Species Staphylococcus aureus [TaxId:1280] [50227] (18 PDB entries)
  8. 2050843Domain d1d5zc1: 1d5z C:2-121 [25186]
    Other proteins in same PDB: d1d5za1, d1d5za2, d1d5zb1, d1d5zb2, d1d5zc2

Details for d1d5zc1

PDB Entry: 1d5z (more details), 2 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with peptidomimetic and seb
PDB Compounds: (C:) protein (enterotoxin type b)

SCOPe Domain Sequences for d1d5zc1:

Sequence, based on SEQRES records: (download)

>d1d5zc1 b.40.2.2 (C:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
dnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvteh

Sequence, based on observed residues (ATOM records): (download)

>d1d5zc1 b.40.2.2 (C:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
dnvrvefknkdladkykdkyvdvfganyyyqcyfskkkrktcmyggvteh

SCOPe Domain Coordinates for d1d5zc1:

Click to download the PDB-style file with coordinates for d1d5zc1.
(The format of our PDB-style files is described here.)

Timeline for d1d5zc1: