SCOPe 2.07: Domain d1d5zc1: 1d5z C:2-121

Lineage for d1d5zc1 (1d5z C:2-121)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50227] (18 PDB entries)

8. Domain d1d5zc1: 1d5z C:2-121 [25186]
   Other proteins in same PDB: d1d5za1, d1d5za2, d1d5zb1, d1d5zb2, d1d5zc2

Details for d1d5zc1

PDB Entry: 1d5z, 2 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with peptidomimetic and seb

PDB Compounds: (C:) protein (enterotoxin type b)

SCOPe Domain Sequences for d1d5zc1:

Sequence, based on SEQRES records:

>d1d5zc1 b.40.2.2 (C:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
dnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvteh

Sequence, based on observed residues (ATOM records):

>d1d5zc1 b.40.2.2 (C:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
dnvrvefknkdladkykdkyvdvfganyyyqcyfskkkrktcmyggvteh

Timeline for d1d5zc1:

• d1d5zc1 first appeared (with stable ids) in SCOP 1.55
  
• d1d5zc1 appears in SCOPe 2.06
  
• d1d5zc1 appears in the current release, SCOPe 2.08