SCOPe 2.04: Domain d4etna_: 4etn A:

Lineage for d4etna_ (4etn A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families)
   share the common active site structure with the family II

5. Family c.44.1.0: automated matches [191415] (1 protein)
   not a true family

6. Protein automated matches [190574] (13 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [193436] (3 PDB entries)

8. Domain d4etna_: 4etn A: [251806]
   automated match to d2wjaa_
   complexed with po4; mutant

Details for d4etna_

PDB Entry: 4etn, 1.1 Å

PDB Description: Crystal structure of YwlE mutant from Bacillus subtilis

PDB Compounds: (A:) Low molecular weight protein-tyrosine-phosphatase ywlE

SCOPe Domain Sequences for d4etna_:

Sequence; same for both SEQRES and ATOM records:

>d4etna_ c.44.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
smdiifvctgntsrspmaealfksiaereglnvnvrsagvfaspngkatphavealfekh
ialnhvssplteelmesadlvlamthqhkqiiasqfgryrdkvftlkeyvtgshgdvldp
fggsidiykqtrdeleellrqlakqlkk

Timeline for d4etna_:

• d4etna_ is new in SCOPe 2.04-stable
  
• d4etna_ appears in SCOPe 2.05
  
• d4etna_ appears in the current release, SCOPe 2.08, called d4etna1