Lineage for d4emtb1 (4emt B:155-337)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011892Fold d.387: STING C-terminal-like [254119] (1 superfamily)
    5 helices and 5 strands in one mixed beta-sheet, one long bent helix
  4. 3011893Superfamily d.387.1: STING, TM173 CTD-like [254144] (2 families) (S)
    Pfam PF15009, PubMed 22579474
  5. 3011894Family d.387.1.1: Tyrosinase cofactor MelC1 [254191] (2 proteins)
  6. 3011895Protein Tyrosinase cofactor MelC1 [254420] (1 species)
  7. 3011896Species Human (Homo sapiens) [TaxId:9606] [254863] (48 PDB entries)
  8. 3011898Domain d4emtb1: 4emt B:155-337 [251780]
    Other proteins in same PDB: d4emta2, d4emtb2
    automated match to d4ef5a_
    complexed with c2e, ca

Details for d4emtb1

PDB Entry: 4emt (more details), 1.5 Å

PDB Description: Crystal Structure of human STING bound to c-di-GMP
PDB Compounds: (B:) Transmembrane protein 173

SCOPe Domain Sequences for d4emtb1:

Sequence, based on SEQRES records: (download)

>d4emtb1 d.387.1.1 (B:155-337) Tyrosinase cofactor MelC1 {Human (Homo sapiens) [TaxId: 9606]}
vahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpdnlsm
adpnirfldklpqqtgdhagikdrvysnsiyellengqragtcvleyatplqtlfamsqy
sqagfsredrleqaklfcrtlediladapesqnncrliayqepaddssfslsqevlrhlr
qee

Sequence, based on observed residues (ATOM records): (download)

>d4emtb1 d.387.1.1 (B:155-337) Tyrosinase cofactor MelC1 {Human (Homo sapiens) [TaxId: 9606]}
vahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpdnlsm
adpnirfldklpqdrvysnsiyellengqragtcvleyatplqtlfamsqysqagfsred
rleqaklfcrtlediladapesqnncrliayqepaddssfslsqevlrhlrqee

SCOPe Domain Coordinates for d4emtb1:

Click to download the PDB-style file with coordinates for d4emtb1.
(The format of our PDB-style files is described here.)

Timeline for d4emtb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4emtb2