SCOPe 2.07: Domain d4e6tc_: 4e6t C:

Lineage for d4e6tc_ (4e6t C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (35 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [193329] (4 PDB entries)

8. Domain d4e6tc_: 4e6t C: [251697]
   Other proteins in same PDB: d4e6ta2, d4e6tb2
   automated match to d4e6ua_
   complexed with flc

Details for d4e6tc_

PDB Entry: 4e6t, 1.8 Å

PDB Description: Structure of LpxA from Acinetobacter baumannii at 1.8A resolution (P212121 form)

PDB Compounds: (C:) acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase

SCOPe Domain Sequences for d4e6tc_:

Sequence; same for both SEQRES and ATOM records:

>d4e6tc_ b.81.1.0 (C:) automated matches {Acinetobacter baumannii [TaxId: 470]}
dlihstaiidpsaviasdvqigpyciigpqvtigagtklhshvvvggftrigqnneifqf
asvgevcqdlkykgeetwleignnnlirehcslhrgtvqdnaltkigshnllmvnthiah
dcivgdhnifannvgvaghvhigdhvivggnsgihqfckidsysmiggaslilkdvpayv
masgnpahafginiegmrrkgwskntiqglreayklifksgltsvqaidqikseilpsvp
eaqllidsleqsergivr

Timeline for d4e6tc_:

• d4e6tc_ first appeared in SCOPe 2.04
  
• d4e6tc_ appears in SCOPe 2.06
  
• d4e6tc_ appears in the current release, SCOPe 2.08