Lineage for d4e2aa_ (4e2a A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1664276Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1664277Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1664807Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 1664808Protein automated matches [190038] (28 species)
    not a true protein
  7. 1664950Species Streptococcus mutans [TaxId:1309] [256244] (1 PDB entry)
  8. 1664951Domain d4e2aa_: 4e2a A: [251649]
    automated match to d1tiqb_

Details for d4e2aa_

PDB Entry: 4e2a (more details), 2 Å

PDB Description: Crystal Structure of the Putative acetyltransferase from Streptococcus mutans
PDB Compounds: (A:) putative acetyltransferase

SCOPe Domain Sequences for d4e2aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e2aa_ d.108.1.0 (A:) automated matches {Streptococcus mutans [TaxId: 1309]}
qveirkvnqdelsllqkiaiqtfretfafdntaeqlqnffdeaytlsvlklelddkeset
yfilmsgkaagflkvnwgssqteqvledafeiqrlyilkayqglglgkqlfefaleraqi
sglswvwlgvweknvkaqllyakygfeqfskhsffvgnkvdtdwllkksl

SCOPe Domain Coordinates for d4e2aa_:

Click to download the PDB-style file with coordinates for d4e2aa_.
(The format of our PDB-style files is described here.)

Timeline for d4e2aa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4e2ab_