SCOPe 2.04: Domain d4dzya2: 4dzy A:186-375

Lineage for d4dzya2 (4dzy A:186-375)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.4: alpha-ketoacid dehydrogenase kinase, C-terminal domain [69804] (3 proteins)

6. Protein automated matches [230554] (2 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [233755] (11 PDB entries)

8. Domain d4dzya2: 4dzy A:186-375 [251637]
   Other proteins in same PDB: d4dzya1
   automated match to d3tz0a2
   complexed with adp, k, mg, wj1

Details for d4dzya2

PDB Entry: 4dzy, 2.1 Å

PDB Description: crystal structure of branched-chain alpha-ketoacid dehydrogenase kinase/(s)-2-chloro-3-phenylpropanoic acid complex with adp

PDB Compounds: (A:) [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial

SCOPe Domain Sequences for d4dzya2:

Sequence, based on SEQRES records:

>d4dzya2 d.122.1.4 (A:186-375) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dfvgiictrlspkkiiekwvdfarrlcehkygnaprvringhvaarfpfipmpldyilpe
llknamratmeshldtpynvpdvvitianndvdliirisdrgggiahkdldrvmdyhftt
aeastqdprisplfghldmhsggqsgpmhgfgfglptsrayaeylggslqlqslqgigtd
vylrlrhidg

Sequence, based on observed residues (ATOM records):

>d4dzya2 d.122.1.4 (A:186-375) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dfvgiictrlspkkiiekwvdfarrlcehkygnaprvringhvaarfpfipmpldyilpe
llknamratmeshldtpynvpdvvitianndvdliirisdrgggiahkdldrvmdyhftt
agfgfglptsrayaeylggslqlqslqgigtdvylrlrhidg

Timeline for d4dzya2:

• d4dzya2 is new in SCOPe 2.04-stable
  
• d4dzya2 appears in SCOPe 2.05
  
• d4dzya2 appears in the current release, SCOPe 2.08