Lineage for d4duwc4 (4duw C:626-730)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762928Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2762929Protein automated matches [254633] (19 species)
    not a true protein
  7. 2763012Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries)
  8. 2763090Domain d4duwc4: 4duw C:626-730 [251599]
    Other proteins in same PDB: d4duwa1, d4duwa3, d4duwa5, d4duwb1, d4duwb3, d4duwb5, d4duwc1, d4duwc3, d4duwc5, d4duwd1, d4duwd3, d4duwd5
    automated match to d1jz8a2
    complexed with dms, mg, na

Details for d4duwc4

PDB Entry: 4duw (more details), 2.2 Å

PDB Description: e. coli (lacz) beta-galactosidase (g974a) in complex with allolactose
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d4duwc4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4duwc4 b.1.4.0 (C:626-730) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d4duwc4:

Click to download the PDB-style file with coordinates for d4duwc4.
(The format of our PDB-style files is described here.)

Timeline for d4duwc4: