![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
![]() | Protein automated matches [226849] (8 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries) |
![]() | Domain d4duwc5: 4duw C:731-1023 [251600] Other proteins in same PDB: d4duwa1, d4duwa2, d4duwa3, d4duwa4, d4duwb1, d4duwb2, d4duwb3, d4duwb4, d4duwc1, d4duwc2, d4duwc3, d4duwc4, d4duwd1, d4duwd2, d4duwd3, d4duwd4 automated match to d1jz8a4 complexed with dms, mg, na |
PDB Entry: 4duw (more details), 2.2 Å
SCOPe Domain Sequences for d4duwc5:
Sequence; same for both SEQRES and ATOM records: (download)
>d4duwc5 b.30.5.0 (C:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndiavseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d4duwc5:
![]() Domains from same chain: (mouse over for more information) d4duwc1, d4duwc2, d4duwc3, d4duwc4 |