SCOPe 2.08: Domain d4dtua1: 4dtu A:1-375

Lineage for d4dtua1 (4dtu A:1-375)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
   contains Pfam PF00929

6. Protein Exonuclease domain of family B DNA polymerases [53125] (8 species)
   elaborated with additional structures and the N-terminal subdomain

7. Species Bacteriophage RB69 [TaxId:12353] [53127] (93 PDB entries)
   additional N-terminal subdomain contains rudimental OB-fold and rudimental ferredoxin-like fold

8. Domain d4dtua1: 4dtu A:1-375 [251560]
   Other proteins in same PDB: d4dtua2
   automated match to d3qesa1
   protein/DNA complex; complexed with ca, dgt
   has additional subdomain(s) that are not in the common domain

Details for d4dtua1

PDB Entry: 4dtu, 1.86 Å

PDB Description: RB69 DNA Polymerase Ternary Complex with dGTP Opposite an Abasic Site and ddC/dG as the Penultimate Base-pair

PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d4dtua1:

Sequence; same for both SEQRES and ATOM records:

>d4dtua1 c.55.3.5 (A:1-375) Exonuclease domain of family B DNA polymerases {Bacteriophage RB69 [TaxId: 12353]}
mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgestak
rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
gklkydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsvfs
piktwdaiifnslke

Timeline for d4dtua1:

• d4dtua1 first appeared in SCOPe 2.04
  
• d4dtua1 appears in SCOPe 2.07