SCOP 1.61: Domain d1ste_1: 1ste 1-120

Lineage for d1ste_1 (1ste 1-120)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.40: OB-fold [50198] (8 superfamilies)

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)

6. Protein Staphylococcal enterotoxin C2, SEC2 [50222] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50223] (7 PDB entries)

8. Domain d1ste_1: 1ste 1-120 [25154]
   Other proteins in same PDB: d1ste_2

Details for d1ste_1

PDB Entry: 1ste, 2 Å

PDB Description: staphylococcal enterotoxin c2 from staphylococcus aureus

SCOP Domain Sequences for d1ste_1:

Sequence; same for both SEQRES and ATOM records:

>d1ste_1 b.40.2.2 (1-120) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus}
esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg

Timeline for d1ste_1:

• d1ste_1 first appeared (with stable ids) in SCOP 1.55
  
• d1ste_1 appears in SCOP 1.59
  
• d1ste_1 appears in SCOP 1.63
  
• d1ste_1 appears in the current release, SCOPe 2.08, called d1stea1