Lineage for d1ptof_ (1pto F:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1540281Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1540282Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 1540587Protein Pertussis toxin S5 subunit [50217] (1 species)
  7. 1540588Species Bordetella pertussis [TaxId:520] [50218] (3 PDB entries)
  8. 1540593Domain d1ptof_: 1pto F: [25144]
    Other proteins in same PDB: d1ptoa_, d1ptob1, d1ptob2, d1ptoc1, d1ptoc2, d1ptod_, d1ptoe_, d1ptog_, d1ptoh1, d1ptoh2, d1ptoi1, d1ptoi2, d1ptoj_, d1ptok_

Details for d1ptof_

PDB Entry: 1pto (more details), 3.5 Å

PDB Description: the structure of a pertussis toxin-sugar complex as a model for receptor binding
PDB Compounds: (F:) pertussis toxin (subunit s5)

SCOPe Domain Sequences for d1ptof_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ptof_ b.40.2.1 (F:) Pertussis toxin S5 subunit {Bordetella pertussis [TaxId: 520]}
lpthlyknftvqelalklkgknqefcltafmsgrslvraclsdaghehdtwfdtmlgfai
sayalksrialtvedspypgtpgdllelqicplngyce

SCOPe Domain Coordinates for d1ptof_:

Click to download the PDB-style file with coordinates for d1ptof_.
(The format of our PDB-style files is described here.)

Timeline for d1ptof_: