| Class b: All beta proteins [48724] (174 folds) |
| Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) ![]() |
| Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
| Protein Pertussis toxin S5 subunit [50217] (1 species) |
| Species Bordetella pertussis [TaxId:520] [50218] (3 PDB entries) |
| Domain d1bcpl_: 1bcp L: [25143] Other proteins in same PDB: d1bcpa_, d1bcpb1, d1bcpb2, d1bcpc1, d1bcpc2, d1bcpd_, d1bcpe_, d1bcpg_, d1bcph1, d1bcph2, d1bcpi1, d1bcpi2, d1bcpj_, d1bcpk_ complexed with atp |
PDB Entry: 1bcp (more details), 2.7 Å
SCOPe Domain Sequences for d1bcpl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bcpl_ b.40.2.1 (L:) Pertussis toxin S5 subunit {Bordetella pertussis [TaxId: 520]}
lpthlyknftvqelalklkgknqefcltafmsgrslvraclsdaghehdtwfdtmlgfai
sayalksrialtvedspypgtpgdllelqicplngyce
Timeline for d1bcpl_: