SCOPe 2.07: Domain d4co9d_: 4co9 D:

Lineage for d4co9d_ (4co9 D:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.8: Putative cyclase [102198] (2 families)
   contains mixed beta-sheet barrel, closed n=7, S=10

5. Family c.8.8.0: automated matches [238093] (1 protein)
   not a true family

6. Protein automated matches [238095] (3 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:198094] [256229] (3 PDB entries)

8. Domain d4co9d_: 4co9 D: [251378]
   automated match to d4coba_
   complexed with dio, gxt, mg, zn

Details for d4co9d_

PDB Entry: 4co9, 1.95 Å

PDB Description: crystal structure of kynurenine formamidase from bacillus anthracis

PDB Compounds: (D:) kynurenine formamidase

SCOPe Domain Sequences for d4co9d_:

Sequence; same for both SEQRES and ATOM records:

>d4co9d_ c.8.8.0 (D:) automated matches {Bacillus anthracis [TaxId: 198094]}
skwidisqplnndiatwpgdtpfsyevlwskeesgsvnvgkltmsihtgthidapfhfdn
dgkkvldldiqvyvgptriidvsnlesigkkelekfhlegverlllrtsshgkanefpdi
iphlradiapflsekgirligvdvpsvdplddkelaahhqlfkhsihilenvvldhvadg
dyelialplalsdadgspvravirpi

Timeline for d4co9d_:

• d4co9d_ first appeared in SCOPe 2.04
  
• d4co9d_ appears in SCOPe 2.06
  
• d4co9d_ appears in the current release, SCOPe 2.08