Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (60 species) not a true protein |
Species Cellvibrio japonicus [TaxId:498211] [256228] (2 PDB entries) |
Domain d4cd5a_: 4cd5 A: [251369] automated match to d1gw1a_ complexed with bma, mvl, na |
PDB Entry: 4cd5 (more details), 1.1 Å
SCOPe Domain Sequences for d4cd5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cd5a_ c.1.8.0 (A:) automated matches {Cellvibrio japonicus [TaxId: 498211]} lpalidtqataetralyrnlaklrykhllfghedslaygvhwegdmdrsdvrdvtganpa vygwelgglelghtanldavnfekmqhwikagysrggvitiswhvfnpvsggnswdktpa vhelipggarhatlkayldtfvafnegladvdaqgnkhyppiifrpwhehngdwfwwgkg haseqdyialwrftvhylrdekklrnliyayspdrsridmanfeagylygypgdayvdii gldnywdvgheantasadeqkaaltaslkqlvqiarskgkiaaltetgnnrltidnfwte rllgpisadadaseiayvmvwrnanlarekseqffapfpgqataddfkrfyqsevvlfed elpplyr
Timeline for d4cd5a_: