![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (52 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [256210] (6 PDB entries) |
![]() | Domain d4cd3a1: 4cd3 A:36-178 [251366] Other proteins in same PDB: d4cd3a2 automated match to d3cj7a1 complexed with 8e9, gol |
PDB Entry: 4cd3 (more details), 2.19 Å
SCOPe Domain Sequences for d4cd3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cd3a1 c.55.1.0 (A:36-178) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} palkygivldagsshtsmfvykwpadkendtgivgqhsscdvqgggissyandpskagqs lvrcleqalrdvprdrhastplylgatagmrllnltspeatarvleavtqtltqypfefr garilsgqdegvfgwvtanylle
Timeline for d4cd3a1: