SCOPe 2.06: Domain d4br5a2: 4br5 A:179-461

Lineage for d4br5a2 (4br5 A:179-461)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.15: NTPDase (Nucleoside triphosphate diphosphohydrolase)-like [254154] (2 proteins)
   Pfam PF01150; relationship to PPX/GPPA (c.55.1.8) discussed in PubMed 18458329

6. Protein automated matches [254739] (1 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [256211] (6 PDB entries)

8. Domain d4br5a2: 4br5 A:179-461 [251319]
   Other proteins in same PDB: d4br5a1
   automated match to d3cj7a2
   complexed with anp, gol, zn

Details for d4br5a2

PDB Entry: 4br5, 1.75 Å

PDB Description: rat ntpdase2 in complex with zn amppnp

PDB Compounds: (A:) Ectonucleoside triphosphate diphosphohydrolase 2

SCOPe Domain Sequences for d4br5a2:

Sequence, based on SEQRES records:

>d4br5a2 c.55.1.15 (A:179-461) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nfikygwvgrwirprkgtlgamdlggastqitfettspsedpgnevhlrlygqhyrvyth
sflcygrdqillrllasalqihrfhpcwpkgystqvllqevyqspctmgqrprafngsai
vslsgtsnatlcrdlvsrlfnisscpfsqcsfngvfqppvagnfiafsafyytvdflttv
mglpvgtlkqleeateitcnqtwtelqarvpgqktrladycavamfihqllsrgyhfder
sfrevvfqkkaadtavgwalgymlnltnlipadlpglrkgthf

Sequence, based on observed residues (ATOM records):

>d4br5a2 c.55.1.15 (A:179-461) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nfikygwvgrwirprkgtlgamdlggastqitfettspsedpgnevhlrlygqhyrvyth
sflcygrdqillrllasalqihrfhpcwpkgystqvllqevyqspctmgqrpgsaivsls
gtsnatlcrdlvsrlfnisscpfsqcsfngvfqppvagnfiafsafyytvdflttvmglp
vgtlkqleeateitcnqtwtelqarvpgqktrladycavamfihqllsrgyhfdersfre
vvfqkkaadtavgwalgymlnltnlipadlpglrkgthf

Timeline for d4br5a2:

• d4br5a2 first appeared in SCOPe 2.04
  
• d4br5a2 appears in SCOPe 2.05
  
• d4br5a2 appears in SCOPe 2.07
  
• d4br5a2 appears in the current release, SCOPe 2.08