Lineage for d4br2a1 (4br2 A:36-178)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2137194Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2138437Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2138438Protein automated matches [226839] (52 species)
    not a true protein
  7. 2138850Species Norway rat (Rattus norvegicus) [TaxId:10116] [256210] (6 PDB entries)
  8. 2138852Domain d4br2a1: 4br2 A:36-178 [251316]
    Other proteins in same PDB: d4br2a2
    automated match to d3cj7a1
    complexed with ca, gol, unp

Details for d4br2a1

PDB Entry: 4br2 (more details), 2 Å

PDB Description: rat NTPDase2 in complex with Ca UMPPNP
PDB Compounds: (A:) Ectonucleoside triphosphate diphosphohydrolase 2

SCOPe Domain Sequences for d4br2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4br2a1 c.55.1.0 (A:36-178) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
palkygivldagsshtsmfvykwpadkendtgivgqhsscdvqgggissyandpskagqs
lvrcleqalrdvprdrhastplylgatagmrllnltspeatarvleavtqtltqypfdfr
garilsgqdegvfgwvtanylle

SCOPe Domain Coordinates for d4br2a1:

Click to download the PDB-style file with coordinates for d4br2a1.
(The format of our PDB-style files is described here.)

Timeline for d4br2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4br2a2