Lineage for d1prtj_ (1prt J:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1313712Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1313713Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 1314004Protein Pertussis toxin S4 subunit [50215] (1 species)
  7. 1314005Species Bordetella pertussis [TaxId:520] [50216] (3 PDB entries)
  8. 1314008Domain d1prtj_: 1prt J: [25130]
    Other proteins in same PDB: d1prta_, d1prtb1, d1prtb2, d1prtc1, d1prtc2, d1prtf_, d1prtg_, d1prth1, d1prth2, d1prti1, d1prti2, d1prtl_

Details for d1prtj_

PDB Entry: 1prt (more details), 2.9 Å

PDB Description: the crystal structure of pertussis toxin
PDB Compounds: (J:) pertussis toxin (subunit s4)

SCOPe Domain Sequences for d1prtj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1prtj_ b.40.2.1 (J:) Pertussis toxin S4 subunit {Bordetella pertussis [TaxId: 520]}
dvpyvlvktnmvvtsvamkpyevtptrmlvcgiaaklgaaasspdahvpfcfgkdlkrpg
sspmevmlravfmqqrplrmflgpkqltfegkpalelirmvecsgkqdcp

SCOPe Domain Coordinates for d1prtj_:

Click to download the PDB-style file with coordinates for d1prtj_.
(The format of our PDB-style files is described here.)

Timeline for d1prtj_: