Lineage for d1prth1 (1prt H:90-199)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1313712Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1313713Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 1313990Protein Pertussis toxin S2/S3 subunits, C-terminal domain [50213] (1 species)
    N-terminal domain in S2/S3 has C-lectin-like fold
  7. 1313991Species Bordetella pertussis [TaxId:520] [50214] (3 PDB entries)
  8. 1313994Domain d1prth1: 1prt H:90-199 [25118]
    Other proteins in same PDB: d1prta_, d1prtb2, d1prtc2, d1prtd_, d1prte_, d1prtf_, d1prtg_, d1prth2, d1prti2, d1prtj_, d1prtk_, d1prtl_

Details for d1prth1

PDB Entry: 1prt (more details), 2.9 Å

PDB Description: the crystal structure of pertussis toxin
PDB Compounds: (H:) pertussis toxin (subunit s2)

SCOPe Domain Sequences for d1prth1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1prth1 b.40.2.1 (H:90-199) Pertussis toxin S2/S3 subunits, C-terminal domain {Bordetella pertussis [TaxId: 520]}
ttrntgqpatdhyysnvtatrllsstnsrlcavfvrsgqpvigactspydgkywsmysrl
rkmlyliyvagisvrvhvskeeqyydyedatfetyaltgisicnpgsslc

SCOPe Domain Coordinates for d1prth1:

Click to download the PDB-style file with coordinates for d1prth1.
(The format of our PDB-style files is described here.)

Timeline for d1prth1: