Class g: Small proteins [56992] (98 folds) |
Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
Superfamily g.8.1: BPTI-like [57362] (4 families) |
Family g.8.1.0: automated matches [191505] (1 protein) not a true family |
Protein automated matches [190829] (13 species) not a true protein |
Species Sabellastarte magnifica [TaxId:389514] [256198] (1 PDB entry) |
Domain d4bd9b2: 4bd9 B:55-109 [251211] automated match to d4dtgk_ complexed with zn |
PDB Entry: 4bd9 (more details), 2.2 Å
SCOPe Domain Sequences for d4bd9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bd9b2 g.8.1.0 (B:55-109) automated matches {Sabellastarte magnifica [TaxId: 389514]} gcnlpskvgpcrvsarmwfhnpetekcevfiyggchgnanrfatetecqevcdry
Timeline for d4bd9b2: